PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12261.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 316aa    MW: 35793.6 Da    PI: 4.9867
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12261.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-121156146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                             +g+W +eEd+ l++ vk+ G+++W++I ++  + Rt+k+c++rw +
  mrna12261.1-v1.0-hybrid 11 KGPWKAEEDQVLLNHVKKCGPKDWSSIRSKGLLQRTGKSCRLRWVN 56
                             79*************************8887799**********87 PP

2Myb_DNA-binding39.61.2e-1267106344
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                              +++ eE+   +++ +q+G++ W++Ia ++  gRt++++k++w
  mrna12261.1-v1.0-hybrid  67 KFSLEEERVVIELQAQFGNK-WAKIATHLA-GRTDNDVKNFW 106
                              799*****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.904662IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-20759IPR009057Homeodomain-like
SuperFamilySSF466893.09E-278106IPR009057Homeodomain-like
SMARTSM007174.5E-101060IPR001005SANT/Myb domain
CDDcd001674.01E-101358No hitNo description
PfamPF139212.3E-121473No hitNo description
Gene3DG3DSA:1.10.10.601.6E-1760112IPR009057Homeodomain-like
PROSITE profilePS5129417.7263114IPR017930Myb domain
SMARTSM007171.3E-1164112IPR001005SANT/Myb domain
CDDcd001672.66E-967106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MEGKREEGIR KGPWKAEEDQ VLLNHVKKCG PKDWSSIRSK GLLQRTGKSC RLRWVNKLRP  60
NLKNGCKFSL EEERVVIELQ AQFGNKWAKI ATHLAGRTDN DVKNFWSSRQ KRLARILQTS  120
TAAITPSKSH KNRREIPVYH DKVPTLEESE YRENPKPFFF KEIPKFSCSS EGESSLQAAS  180
CSSRCIGNSE MVPVPELVDS KLLGFEADPV QQELALPAEK NLWIESQPLI PFLENPQPQT  240
DLEFSSDTQE LLKLDFDMLT TLDAELSKQL DIGPPFLEPV GNVEGDKIDD PITPDCLFDD  300
FPADMFDQIE PLSHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-25911225126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289595.10.0PREDICTED: transcription factor MYB29-like
TrEMBLM5VT831e-139M5VT83_PRUPE; Uncharacterized protein
STRINGVIT_15s0021g02040.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.16e-75MYB family protein